Loading...
Statistics
Advertisement

White House Health & Fitness – Join the Journey!
www.whhealthandfitness.com/
Welcome to White House Health and Fitness! Constantly striving to be the best we can be through healthy choices, hard work and consistency, and social ...

Whhealthandfitness.com

Advertisement
Whhealthandfitness.com is hosted in United States / San Francisco . Whhealthandfitness.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Whhealthandfitness.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • form.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Facebook Box

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Whhealthandfitness.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 297595277161820265874349418054836283398813
    • validFrom: 160404130800Z
    • validTo: 160703130800Z
    • validFrom_time_t: 1459775280
    • validTo_time_t: 1467551280
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: ED:4E:EE:D6:E8:26:D4:AA:ED:70:52:76:0F:DE:02:20:99:C7:38:B6
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whetstoneandassociates.com, DNS:whetstoneathletics.com, DNS:whetyourwanderlust.com, DNS:whetyourwoman.com, DNS:whetzgood.com, DNS:whey-protein-info.com, DNS:wheyinonthecurds.com, DNS:wheymouthbohemian.com, DNS:whf-pa.org, DNS:whfarmacy.com, DNS:whgoftampa.com, DNS:whhealthandfitness.com, DNS:whichcraftandwhimsy.com, DNS:whichdigitalblog.com, DNS:whichhalfoftheglass.com, DNS:whichmitch.com, DNS:whichonesam.com, DNS:whichsailboat.com, DNS:whichshoestoday.com, DNS:whichwayisup.me, DNS:whichwaytomongolia.com, DNS:whidbeybicycleclub.org, DNS:whidbeycarenet.org, DNS:whidbeyfocus.com, DNS:whidbeyislandcarpentry.com, DNS:whidbeyislandelectricbikerentals.com, DNS:whidbeyislandgirl.net, DNS:whidbeyislandtreasurehunt.com, DNS:whidbeyislandyoga.com, DNS:whidbeymothermentors.org, DNS:whidbeystudents.com, DNS:whidbeywildlifehabitat.com, DNS:whiffofcordite.com, DNS:whifftestbuddysystem.com, DNS:while-here.com, DNS:while-you-were-sleeping.com, DNS:whileatoxford.com, DNS:whileatthezoo.com, DNS:whileawaytheday.com, DNS:whileawaythehoursblog.com, DNS:whiledarceysleeps.com, DNS:whileguide.com, DNS:whilehavingtea.com, DNS:whileiamthinkingaboutit.com, DNS:whileifelse.com, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileiwasreading.com, DNS:whilemaandpawsawaypetservices.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Whhealthandfitness.com

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:image:src
    Content: https://whhealthandfitness.files.wordpress.com/2015/08/wallpaper_9.jpg?w=640
  • Name: twitter:card
    Content: summary_large_image
  • Name: application-name
    Content: White House Health & Fitness
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Join the Journey!
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Home | White House Health & Fitness on WordPress.com
  • Name: description
    Content: Welcome to White House Health and Fitness! Constantly striving to be the best we can be through healthy choices, hard work and consistency, and social responsibility. Join the journey!

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns3.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 18 Apr 2016 14:20:04 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://whhealthandfitness.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Mon, 18 Apr 2016 14:20:04 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. X-Pingback: https://whhealthandfitness.com/xmlrpc.php Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: whhealthandfitness.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 192.0.78.25
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 192.0.78.24
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hhealthandfitness.com, www.w hhealthandfitness.com, www. hhealthandfitness.com, www.wchhealthandfitness.com, www.chhealthandfitness.com, www.whhealthandfitness.com, www.hhealthandfitness.com, www.wdhhealthandfitness.com, www.dhhealthandfitness.com, www.wfhhealthandfitness.com, www.fhhealthandfitness.com, www.wghhealthandfitness.com, www.ghhealthandfitness.com, www.wbhhealthandfitness.com, www.bhhealthandfitness.com, www.whealthandfitness.com, www.whehealthandfitness.com, www.wehealthandfitness.com, www.whdhealthandfitness.com, www.wdhealthandfitness.com, www.whchealthandfitness.com, www.wchealthandfitness.com, www.whuhealthandfitness.com, www.wuhealthandfitness.com, www.whjhealthandfitness.com, www.wjhealthandfitness.com, www.whhealthandfitness.com, www.whealthandfitness.com, www.whbhealthandfitness.com, www.wbhealthandfitness.com, www.whghealthandfitness.com, www.wghealthandfitness.com, www.whealthandfitness.com, www.whheealthandfitness.com, www.wheealthandfitness.com, www.whhdealthandfitness.com, www.whdealthandfitness.com, www.whhcealthandfitness.com, www.whcealthandfitness.com, www.whhuealthandfitness.com, www.whuealthandfitness.com, www.whhjealthandfitness.com, www.whjealthandfitness.com, www.whhealthandfitness.com, www.whealthandfitness.com, www.whhbealthandfitness.com, www.whbealthandfitness.com, www.whhgealthandfitness.com, www.whgealthandfitness.com, www.whhalthandfitness.com, www.whhexalthandfitness.com, www.whhxalthandfitness.com, www.whhesalthandfitness.com, www.whhsalthandfitness.com, www.whhewalthandfitness.com, www.whhwalthandfitness.com, www.whheralthandfitness.com, www.whhralthandfitness.com, www.whhefalthandfitness.com, www.whhfalthandfitness.com, www.whhevalthandfitness.com, www.whhvalthandfitness.com, www.whhecalthandfitness.com, www.whhcalthandfitness.com, www.whheqalthandfitness.com, www.whhqalthandfitness.com, www.whheaalthandfitness.com, www.whhaalthandfitness.com, www.whheyalthandfitness.com, www.whhyalthandfitness.com, www.whhelthandfitness.com, www.whheaolthandfitness.com, www.whheolthandfitness.com, www.whheaplthandfitness.com, www.whheplthandfitness.com, www.whhea9lthandfitness.com, www.whhe9lthandfitness.com, www.whhealthandfitness.com, www.whhelthandfitness.com, www.whheailthandfitness.com, www.whheilthandfitness.com, www.whheaulthandfitness.com, www.whheulthandfitness.com, www.whheathandfitness.com, www.whhealuthandfitness.com, www.whheauthandfitness.com, www.whheal8thandfitness.com, www.whhea8thandfitness.com, www.whheal9thandfitness.com, www.whhea9thandfitness.com, www.whhealjthandfitness.com, www.whheajthandfitness.com, www.whheal0thandfitness.com, www.whhea0thandfitness.com, www.whhealmthandfitness.com, www.whheamthandfitness.com, www.whhealpthandfitness.com, www.whheapthandfitness.com, www.whhealothandfitness.com, www.whheaothandfitness.com, www.whhealhandfitness.com, www.whhealtqhandfitness.com, www.whhealqhandfitness.com, www.whhealtahandfitness.com, www.whhealahandfitness.com, www.whhealt handfitness.com, www.whheal handfitness.com, www.whhealtwhandfitness.com, www.whhealwhandfitness.com, www.whhealtehandfitness.com, www.whhealehandfitness.com, www.whhealtzhandfitness.com, www.whhealzhandfitness.com, www.whhealtxhandfitness.com, www.whhealxhandfitness.com, www.whhealtchandfitness.com, www.whhealchandfitness.com, www.whhealtandfitness.com, www.whhealtheandfitness.com, www.whhealteandfitness.com, www.whhealthdandfitness.com, www.whhealtdandfitness.com, www.whhealthcandfitness.com, www.whhealtcandfitness.com, www.whhealthuandfitness.com, www.whhealtuandfitness.com, www.whhealthjandfitness.com, www.whhealtjandfitness.com, www.whhealthandfitness.com, www.whhealtandfitness.com, www.whhealthbandfitness.com, www.whhealtbandfitness.com, www.whhealthgandfitness.com, www.whhealtgandfitness.com, www.whhealthndfitness.com, www.whhealthaondfitness.com, www.whhealthondfitness.com, www.whhealthapndfitness.com, www.whhealthpndfitness.com, www.whhealtha9ndfitness.com, www.whhealth9ndfitness.com, www.whhealthandfitness.com, www.whhealthndfitness.com, www.whhealthaindfitness.com, www.whhealthindfitness.com, www.whhealthaundfitness.com, www.whhealthundfitness.com, www.whhealthadfitness.com, www.whhealthanndfitness.com, www.whhealthandfitness.com, www.whhealthanhdfitness.com, www.whhealthahdfitness.com, www.whhealthanjdfitness.com, www.whhealthajdfitness.com, www.whhealthankdfitness.com, www.whhealthakdfitness.com, www.whhealthanldfitness.com, www.whhealthaldfitness.com, www.whhealthan dfitness.com, www.whhealtha dfitness.com, www.whhealthanfitness.com, www.whhealthandtfitness.com, www.whhealthantfitness.com, www.whhealthandgfitness.com, www.whhealthangfitness.com, www.whhealthandbfitness.com, www.whhealthanbfitness.com, www.whhealthandxfitness.com, www.whhealthanxfitness.com, www.whhealthandsfitness.com, www.whhealthansfitness.com, www.whhealthandffitness.com, www.whhealthanffitness.com, www.whhealthandvfitness.com, www.whhealthanvfitness.com, www.whhealthandyfitness.com, www.whhealthanyfitness.com, www.whhealthandzfitness.com, www.whhealthanzfitness.com, www.whhealthandafitness.com, www.whhealthanafitness.com, www.whhealthandefitness.com, www.whhealthanefitness.com, www.whhealthandrfitness.com, www.whhealthanrfitness.com,

Other websites we recently analyzed

  1. Benji Caine | We R Da Streetz Presents: Benji Caine
    Wilmington (United States) - 104.167.11.217
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, Schema.org, SVG
    Number of Javascript: 12
    Number of meta tags: 3
  2. jtwilliams.com
    Los Angeles (United States) - 208.73.210.214
    Server software: Apache
    Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  3. Інтернет-магазин Zahid-Moto, Україна м. Луцьк: мото запчастини, скутер запчастини, аксесуари мото
    Інтернет магазин Zahid-Moto, нові запчастини до мотоциклів, мопедів, скутерів та аксесуари. ПРОДАЖ, ДОСТАВКА, СЕРВІС, ГАРАНТІЯ.
    Ukraine - 176.114.1.52
    Server software: nginx
    Technology: CSS, Html, Javascript, jQuery Cookie, jQuery Validate, jQuery UI, Php, Yandex.Metrika, Google Analytics
    Number of Javascript: 13
    Number of meta tags: 3
  4. Kathrine Light - Dexter Associates Realty
    Whether you are a buyer, a seller, an investor, or just browsing the market, here you will find all the information you need to make an informed decision. The real estate market can be overwhelming. M
    Vancouver (Canada) - 199.167.19.89
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, AJAX Libraries API, CSS, Font Awesome, Google Font API, Html, Html5
    Number of Javascript: 1
    Number of meta tags: 3
  5. Home
    zahnärztliche und naturheilkundliche Praxis - Zahnärzte - Akupunktur - TCM - Umweltzahnmedizin - Naturheilkunde - Homöopathie - Implantate - Ästhetische Zahnheilkunde - Ausbildung ZMA
    Berlin (Germany) - 81.169.145.74
    Server software: Apache/2.2.31 (Unix)
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 3
  6. Corona Garden ::: conifere, arbusti, arbusti florali ornamentali, flori, iazuri
    Corona Garden comercializeaza prin garden center-ul propriu, material dendrologic din pepiniera proprie si import : plante vesnic verzi ( conifere ) , arbusti , arbusti florali ornamentali, arbori , un bogat sortiment de plante urcatoare , plante perene, flori uscate , flori pentru parcuri , gradini, terase si balcoane ; peste 250 de specii si varietatii .
    Romania - 85.9.56.199
    Server software: +
    Technology: Html, Javascript, Swf Object
    Number of Javascript: 1
    Number of meta tags: 4
  7. sprachen24shop.info - Diese Website steht zum Verkauf! - Informationen zum Thema sprachen24shop.
    Diese
    Cambridge (United States) - 72.52.4.90
    Server software: Apache/2.2.22 (Debian)
    Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
    Number of Javascript: 3
    Number of meta tags: 5
  8. A Traveler's Guide to the Spirit Realm
    Explore the Spirit realm God created just for you.
    Sunnyvale (United States) - 98.139.134.174
    Server software: ATS/5.0.1
    Technology: CSS, Html
    Number of Javascript: 1
    Number of meta tags: 3
  9. Invisible Kids. For the safety of asylum seekers' children. Tel Aviv
    To raise awareness and funds for Mesila, in order to help save and protect 'at risk' children in Tel Aviv
    Ashburn (United States) - 54.88.39.163
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript, Php, Wix
    Number of Javascript: 2
    Number of meta tags: 7
  10. Системы автономного отопления: Очевидные преимущества автономного отопления
    Очевидные преимущества автономного отопления: полезная информация о современных отопительных системах, профессиональная установка систем отопления
    Russian Federation - 77.222.56.43
    Server software: nginx/1.7.6
    Technology: Google Adsense, CSS, Html, Javascript, LiveInternet counter
    Number of Javascript: 1
    Number of meta tags: 3

Check Other Websites