Loading...
Statistics
Advertisement

White House Health & Fitness – Join the Journey!
www.whhealthandfitness.com/
Welcome to White House Health and Fitness! Constantly striving to be the best we can be through healthy choices, hard work and consistency, and social ...

Whhealthandfitness.com

Advertisement
Whhealthandfitness.com is hosted in United States / San Francisco . Whhealthandfitness.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 7. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Whhealthandfitness.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 7
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • form.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 1
  • Facebook Box

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Whhealthandfitness.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 297595277161820265874349418054836283398813
    • validFrom: 160404130800Z
    • validTo: 160703130800Z
    • validFrom_time_t: 1459775280
    • validTo_time_t: 1467551280
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: ED:4E:EE:D6:E8:26:D4:AA:ED:70:52:76:0F:DE:02:20:99:C7:38:B6
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:tls.automattic.com, DNS:whetstoneandassociates.com, DNS:whetstoneathletics.com, DNS:whetyourwanderlust.com, DNS:whetyourwoman.com, DNS:whetzgood.com, DNS:whey-protein-info.com, DNS:wheyinonthecurds.com, DNS:wheymouthbohemian.com, DNS:whf-pa.org, DNS:whfarmacy.com, DNS:whgoftampa.com, DNS:whhealthandfitness.com, DNS:whichcraftandwhimsy.com, DNS:whichdigitalblog.com, DNS:whichhalfoftheglass.com, DNS:whichmitch.com, DNS:whichonesam.com, DNS:whichsailboat.com, DNS:whichshoestoday.com, DNS:whichwayisup.me, DNS:whichwaytomongolia.com, DNS:whidbeybicycleclub.org, DNS:whidbeycarenet.org, DNS:whidbeyfocus.com, DNS:whidbeyislandcarpentry.com, DNS:whidbeyislandelectricbikerentals.com, DNS:whidbeyislandgirl.net, DNS:whidbeyislandtreasurehunt.com, DNS:whidbeyislandyoga.com, DNS:whidbeymothermentors.org, DNS:whidbeystudents.com, DNS:whidbeywildlifehabitat.com, DNS:whiffofcordite.com, DNS:whifftestbuddysystem.com, DNS:while-here.com, DNS:while-you-were-sleeping.com, DNS:whileatoxford.com, DNS:whileatthezoo.com, DNS:whileawaytheday.com, DNS:whileawaythehoursblog.com, DNS:whiledarceysleeps.com, DNS:whileguide.com, DNS:whilehavingtea.com, DNS:whileiamthinkingaboutit.com, DNS:whileifelse.com, DNS:whileimwaitingblog.com, DNS:whileinaustralia.com, DNS:whileinheels.com, DNS:whileiwasreading.com, DNS:whilemaandpawsawaypetservices.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Whhealthandfitness.com

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: viewport
    Content: width=device-width, initial-scale=1
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: twitter:image:src
    Content: https://whhealthandfitness.files.wordpress.com/2015/08/wallpaper_9.jpg?w=640
  • Name: twitter:card
    Content: summary_large_image
  • Name: application-name
    Content: White House Health & Fitness
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Join the Journey!
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Home | White House Health & Fitness on WordPress.com
  • Name: description
    Content: Welcome to White House Health and Fitness! Constantly striving to be the best we can be through healthy choices, hard work and consistency, and social responsibility. Join the journey!

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns3.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Mon, 18 Apr 2016 14:20:04 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Location: https://whhealthandfitness.com/ X-ac: 3.ams _dca HTTP/1.1 200 OK Server: nginx Date: Mon, 18 Apr 2016 14:20:04 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. X-Pingback: https://whhealthandfitness.com/xmlrpc.php Link: ; rel=shortlink X-ac: 3.ams _dca

DNS

host: whhealthandfitness.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 192.0.78.25
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 299
  3. type: A
  4. ip: 192.0.78.24
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: whhealthandfitness.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hhealthandfitness.com, www.w hhealthandfitness.com, www. hhealthandfitness.com, www.wchhealthandfitness.com, www.chhealthandfitness.com, www.whhealthandfitness.com, www.hhealthandfitness.com, www.wdhhealthandfitness.com, www.dhhealthandfitness.com, www.wfhhealthandfitness.com, www.fhhealthandfitness.com, www.wghhealthandfitness.com, www.ghhealthandfitness.com, www.wbhhealthandfitness.com, www.bhhealthandfitness.com, www.whealthandfitness.com, www.whehealthandfitness.com, www.wehealthandfitness.com, www.whdhealthandfitness.com, www.wdhealthandfitness.com, www.whchealthandfitness.com, www.wchealthandfitness.com, www.whuhealthandfitness.com, www.wuhealthandfitness.com, www.whjhealthandfitness.com, www.wjhealthandfitness.com, www.whhealthandfitness.com, www.whealthandfitness.com, www.whbhealthandfitness.com, www.wbhealthandfitness.com, www.whghealthandfitness.com, www.wghealthandfitness.com, www.whealthandfitness.com, www.whheealthandfitness.com, www.wheealthandfitness.com, www.whhdealthandfitness.com, www.whdealthandfitness.com, www.whhcealthandfitness.com, www.whcealthandfitness.com, www.whhuealthandfitness.com, www.whuealthandfitness.com, www.whhjealthandfitness.com, www.whjealthandfitness.com, www.whhealthandfitness.com, www.whealthandfitness.com, www.whhbealthandfitness.com, www.whbealthandfitness.com, www.whhgealthandfitness.com, www.whgealthandfitness.com, www.whhalthandfitness.com, www.whhexalthandfitness.com, www.whhxalthandfitness.com, www.whhesalthandfitness.com, www.whhsalthandfitness.com, www.whhewalthandfitness.com, www.whhwalthandfitness.com, www.whheralthandfitness.com, www.whhralthandfitness.com, www.whhefalthandfitness.com, www.whhfalthandfitness.com, www.whhevalthandfitness.com, www.whhvalthandfitness.com, www.whhecalthandfitness.com, www.whhcalthandfitness.com, www.whheqalthandfitness.com, www.whhqalthandfitness.com, www.whheaalthandfitness.com, www.whhaalthandfitness.com, www.whheyalthandfitness.com, www.whhyalthandfitness.com, www.whhelthandfitness.com, www.whheaolthandfitness.com, www.whheolthandfitness.com, www.whheaplthandfitness.com, www.whheplthandfitness.com, www.whhea9lthandfitness.com, www.whhe9lthandfitness.com, www.whhealthandfitness.com, www.whhelthandfitness.com, www.whheailthandfitness.com, www.whheilthandfitness.com, www.whheaulthandfitness.com, www.whheulthandfitness.com, www.whheathandfitness.com, www.whhealuthandfitness.com, www.whheauthandfitness.com, www.whheal8thandfitness.com, www.whhea8thandfitness.com, www.whheal9thandfitness.com, www.whhea9thandfitness.com, www.whhealjthandfitness.com, www.whheajthandfitness.com, www.whheal0thandfitness.com, www.whhea0thandfitness.com, www.whhealmthandfitness.com, www.whheamthandfitness.com, www.whhealpthandfitness.com, www.whheapthandfitness.com, www.whhealothandfitness.com, www.whheaothandfitness.com, www.whhealhandfitness.com, www.whhealtqhandfitness.com, www.whhealqhandfitness.com, www.whhealtahandfitness.com, www.whhealahandfitness.com, www.whhealt handfitness.com, www.whheal handfitness.com, www.whhealtwhandfitness.com, www.whhealwhandfitness.com, www.whhealtehandfitness.com, www.whhealehandfitness.com, www.whhealtzhandfitness.com, www.whhealzhandfitness.com, www.whhealtxhandfitness.com, www.whhealxhandfitness.com, www.whhealtchandfitness.com, www.whhealchandfitness.com, www.whhealtandfitness.com, www.whhealtheandfitness.com, www.whhealteandfitness.com, www.whhealthdandfitness.com, www.whhealtdandfitness.com, www.whhealthcandfitness.com, www.whhealtcandfitness.com, www.whhealthuandfitness.com, www.whhealtuandfitness.com, www.whhealthjandfitness.com, www.whhealtjandfitness.com, www.whhealthandfitness.com, www.whhealtandfitness.com, www.whhealthbandfitness.com, www.whhealtbandfitness.com, www.whhealthgandfitness.com, www.whhealtgandfitness.com, www.whhealthndfitness.com, www.whhealthaondfitness.com, www.whhealthondfitness.com, www.whhealthapndfitness.com, www.whhealthpndfitness.com, www.whhealtha9ndfitness.com, www.whhealth9ndfitness.com, www.whhealthandfitness.com, www.whhealthndfitness.com, www.whhealthaindfitness.com, www.whhealthindfitness.com, www.whhealthaundfitness.com, www.whhealthundfitness.com, www.whhealthadfitness.com, www.whhealthanndfitness.com, www.whhealthandfitness.com, www.whhealthanhdfitness.com, www.whhealthahdfitness.com, www.whhealthanjdfitness.com, www.whhealthajdfitness.com, www.whhealthankdfitness.com, www.whhealthakdfitness.com, www.whhealthanldfitness.com, www.whhealthaldfitness.com, www.whhealthan dfitness.com, www.whhealtha dfitness.com, www.whhealthanfitness.com, www.whhealthandtfitness.com, www.whhealthantfitness.com, www.whhealthandgfitness.com, www.whhealthangfitness.com, www.whhealthandbfitness.com, www.whhealthanbfitness.com, www.whhealthandxfitness.com, www.whhealthanxfitness.com, www.whhealthandsfitness.com, www.whhealthansfitness.com, www.whhealthandffitness.com, www.whhealthanffitness.com, www.whhealthandvfitness.com, www.whhealthanvfitness.com, www.whhealthandyfitness.com, www.whhealthanyfitness.com, www.whhealthandzfitness.com, www.whhealthanzfitness.com, www.whhealthandafitness.com, www.whhealthanafitness.com, www.whhealthandefitness.com, www.whhealthanefitness.com, www.whhealthandrfitness.com, www.whhealthanrfitness.com,

Other websites we recently analyzed

  1. SUZ & RON
    New York (United States) - 198.49.23.144
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, Squarespace
    Number of Javascript: 3
    Number of meta tags: 7
  2. tcm99online.com
    ±±¾©Óù·½ÌÃÖÐҽ¹ǿƣ¬ÊÇÊÀ½çÖÐҽҩѧ»áÁªºϻáÖÐҽ¹Dz¡ÔÚÖйúΨһָ֨Áٴ²ÖÎÁƻùµأ¬ÒÔԭÝéÃû²¿¶ӾüҽÉò־ÎäΪ´øͷÈˣ¬ӦÓÃÖÐҽ¾ø¼¼ÖصãÖÎÁÆÑü׵¼äÅÌͻ³ö,¾±׵ҡ,¹ÇÖÊÔöÉúµÈÍç¹ÌÐԹDzc̼ûЧ¿ìÎÞÈκθ±×÷Óá£
    Hangzhou (China) - 112.124.35.18
    Server software: Apache/2.0.63 (Win32) PHP/5.2.14
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 14
    Number of meta tags: 3
  3. IntelliClick E-mail And Web Site Marketing
    Enhance your Goldmine or ACT! email campaign with IntelliClick Software & instantly track email campaigns and identify campaign & website effectiveness
    Wayne (United States) - 74.208.92.33
    Server software: Apache
    Technology: CSS, Cufon, Google Font API, Html, Iframe, Javascript, jQuery, jQuery Colorbox, Php
    Number of Javascript: 15
    Number of meta tags: 5
  4. 用户信息
    Tokyo (Japan) - 50.31.240.218
    Server software: Apache/2.4.6 (Debian)
    Technology: CSS, Font Awesome, Html, Html5, Javascript
    Number of Javascript: 6
    Number of meta tags: 2
  5. Beddoes Institute – Measure, Diagnose, Act
    Brea (United States) - 69.163.184.86
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, SVG, Wordpress
    Number of Javascript: 8
    Number of meta tags: 3
  6. Kids Play The Hague - Home
    Kids Play The Hague, the newest venue in downtown Den Haag to celebrate all your children-related events: (birthday) parties, mother/children workshops, playgroups, and more.
    San Francisco (United States) - 199.34.228.73
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 7
    Number of meta tags: 3
  7. Web Dev by Sunfire
    Building your Home on the Web. Connie 'Sunfire' Hill is a Web Developer in Wenatchee, WA with experience in HTML, CSS, Javascript, and Wordpress, including custom layout and design work.
    Scottsdale (United States) - 160.153.45.68
    Server software: Apache/2.4.18
    Technology: CSS, Google Font API, Html, Html5, Javascript, Php, SVG, Google +1 Button
    Number of Javascript: 5
    Number of meta tags: 5
  8. Doga Towels | Luxury Organic Bamboo Cotton Blend Towels and Bathrobes
    Simply the most luxurious, softest, most durable towel. We engineered every part of Doga - from the weave to the thread itself - to give YOU the ultimate towel!
    Ottawa (Canada) - 23.227.38.32
    G Analytics ID: UA-69908949-1
    Server software: nginx
    Technology: Carousel, CSS, Flexslider, Google Font API, Html, Javascript, jQuery Fancybox, Google Analytics, Shopify, Facebook Box
    Number of Javascript: 25
    Number of meta tags: 3
  9. TSWW
    TSWW - Die Tennisschule Wenger & Wiesinger bietet Tennistraining nach modernen Trainsmethoden und mit viel Begeisterung am und für den Sport.
    New York (United States) - 198.49.23.145
    Server software: Apache
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 1
    Number of meta tags: 7
  10. Forums - IPS Community Suite
    France - 176.31.227.79
    Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Html, Html5, Php
    Number of Javascript: 8
    Number of meta tags: 3

Check Other Websites